Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody(monoclonal, 3H5)

HSP70/HSPA1A antibody

Boster Bio Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody (monoclonal, 3H5) catalog # M00949-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Product Info Summary

SKU: M00949-Dyl488
Size: 100 μg/vial
Reactive Species: Human
Host: Mouse
Application: Flow Cytometry

Product Name

Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody(monoclonal, 3H5)

View all HSP70/HSPA1A Antibodies

SKU/Catalog Number

M00949-Dyl488

Size

100 μg/vial

Form

Liquid

Description

Boster Bio Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody (monoclonal, 3H5) catalog # M00949-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Storage & Handling

At -20°C for one year from date of receipt. Avoid repeated freezing and thawing. Protect from light.

Cite This Product

Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody(monoclonal, 3H5) (Boster Biological Technology, Pleasanton CA, USA, Catalog # M00949-Dyl488)

Host

Mouse

Contents

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Clonality

Monoclonal

Clone Number

3H5

Isotype

Mouse IgG1

Immunogen

A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70, different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids.

*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.

Cross-reactivity

No cross-reactivity with other proteins.

Reactive Species

M00949-Dyl488 is reactive to HSPA1A in Human

Applications

M00949-Dyl488 is guaranteed for Flow Cytometry Boster Guarantee

Observed Molecular Weight

39 kDa

Calculated molecular weight

70.052kDa

Background of HSP70/HSPA1A

HSPA1 (heat shock 70kDa protein 1A) also known as HSP70-1, HSPA1A, HSP70-1A, HSP72 or HSP70I, is a protein that in humans is encoded by the HSPA1A gene. This intronless gene encodes a 70kDa heat shock protein which is a member of the heat shock protein 70 family. The HSPA1A gene encodes a predicted 641-amino acid protein. The HSPA1 gene is mapped on 6p21.33. Shimizu et al. (1999) found that peripheral blood mononuclear cells of 18 major depression patients expressed a short HSPA1A transcript that utilized exon 1 rather than exon 2, which is found in the more common HSPA1A transcript. No protein was associated with expression of this short HSPA1A mRNA, possibly due to lack of a TATA box or loss of internal ribosome binding sites. Treatment with BGP-15, a pharmacologic inducer of Hsp72 that can protect against obesity-induced insulin resistance, improved muscular architecture, strength, and contractile function in severely affected diaphragm muscles in mdx dystrophic mice.

Antibody Validation

Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.

View more details

Innovating Scientists Reward

If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.

Submit A Review

Assay Dilutions Recommendation

The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.

Flow Cytometry, 1-3μg/1x106 cells

Validation Images & Assay Conditions

Gene/Protein Information For HSPA1A (Source: Uniprot.org, NCBI)

Gene Name

HSPA1A

Full Name

Heat shock 70 kDa protein 1A

Weight

70.052kDa

Superfamily

heat shock protein 70 family

Alternative Names

dnaK-type molecular chaperone HSP70-1; FLJ54303; FLJ54370; FLJ54392; FLJ54408; FLJ75127; Heat shock 70 kDa protein 1/2; heat shock 70 kDa protein 1A/1B; heat shock 70kD protein 1A; heat shock 70kDa protein 1A; heat shock-induced protein; HSP70; HSP70.1/HSP70.2; HSP70-1; HSP70-1/HSP70-2; HSP70-1A; HSP70I; HSP72; HSPA1; HSPA1A; HSPA1B HSPA1A HEL-S-103, HSP70-1, HSP70-1A, HSP70-2, HSP70.1, HSP70.2, HSP70I, HSP72, HSPA1 heat shock protein family A (Hsp70) member 1A heat shock 70 kDa protein 1A|HSP70-1/HSP70-2|HSP70.1/HSP70.2|Heat shock 70 kDa protein 1B|Heat shock 70 kDa protein 2|dnaK-type molecular chaperone HSP70-1|epididymis secretory protein Li 103|epididymis secretory sperm binding protein|heat shock 70 kDa protein 1|heat shock 70 kDa protein 1/2|heat shock 70 kDa protein 1A/1B|heat shock 70kD protein 1A|heat shock 70kDa protein 1A|heat shock-induced protein

*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".

For more info on HSPA1A, check out the HSPA1A Infographic

HSPA1A infographic

We have 30,000+ of these available, one for each gene! Check them out.

In this infographic, you will see the following information for HSPA1A: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].

Hello CJ!

No publications found for M00949-Dyl488

*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.

Have you used Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody(monoclonal, 3H5)?

Submit a review and receive an Amazon gift card.

  • $30 for a review with an image

Be the first to review Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody(monoclonal, 3H5)

*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.

Have a question?

Find answers in Q&As, reviews.

Can't find your answer?

Submit your question

14 Customer Q&As for Anti-Human Hsp70 DyLight® 488 conjugated HSPA1A Antibody(monoclonal, 3H5)

Question

I was wanting to use your anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) for Flow Cytometry for human pns skin on frozen tissues, but I want to know if it has been tested for this particular application. Has this antibody been tested and is this antibody a good choice for human pns skin identification?

Verified Customer

Verified customer

Asked: 2020-04-22

Answer

You can see on the product datasheet, M00949-Dyl488 anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) has been tested for Flow Cytometry on human tissues. We have an innovator award program that if you test this antibody and show it works in human pns skin in IHC-frozen, you can get your next antibody for free.

Boster Scientific Support

Answered: 2020-04-22

Question

We are currently using anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 for human tissue, and we are well pleased with the Flow Cytometry results. The species of reactivity given in the datasheet says human. Is it likely that the antibody can work on zebrafish tissues as well?

Verified Customer

Verified customer

Asked: 2020-01-09

Answer

The anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) (M00949-Dyl488) has not been tested for cross reactivity specifically with zebrafish tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in zebrafish you can get your next antibody for free. Please contact me if I can help you with anything.

Boster Scientific Support

Answered: 2020-01-09

Question

Is a blocking peptide available for product anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) (M00949-Dyl488)?

Verified Customer

Verified customer

Asked: 2019-11-05

Answer

We do provide the blocking peptide for product anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) (M00949-Dyl488). If you would like to place an order for it please contact [email protected] and make a special request.

Boster Scientific Support

Answered: 2019-11-05

Question

Our lab were well pleased with the WB result of your anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5). However we have observed positive staining in embryonic kidney cytoplasm. using this antibody. Is that expected? Could you tell me where is HSPA1A supposed to be expressed?

Verified Customer

Verified customer

Asked: 2019-06-14

Answer

According to literature, embryonic kidney does express HSPA1A. Generally HSPA1A expresses in cytoplasm. Regarding which tissues have HSPA1A expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 23349634
Brain, Muscle, Pancreas, PNS, and Skin, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2019-06-14

Question

My question regards to test anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 on human pns skin for research purposes, then I may be interested in using anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 for diagnostic purposes as well. Is the antibody suitable for diagnostic purposes?

Verified Customer

Verified customer

Asked: 2019-06-12

Answer

The products we sell, including anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488, are only intended for research use. They would not be suitable for use in diagnostic work. If you have the means to develop a product into diagnostic use, and are interested in collaborating with us and develop our product into an IVD product, please contact us for more discussions.

Boster Scientific Support

Answered: 2019-06-12

Question

Would M00949-Dyl488 anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) work on parafin embedded sections? If so, which fixation method do you recommend we use (PFA, paraformaldehyde, other)?

Verified Customer

Verified customer

Asked: 2019-05-27

Answer

You can see on the product datasheet, M00949-Dyl488 anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) as been tested on Flow Cytometry. It is best to use PFA for fixation because it has better tissue penetration ability. PFA needs to be prepared fresh before use. Long term stored PFA turns into formalin, as the PFA molecules congregate and become formalin.

Boster Scientific Support

Answered: 2019-05-27

Question

See attached the WB image, lot number and protocol we used for pns skin using anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488. Please let me know if you require anything else.

Verified Customer

Verified customer

Asked: 2019-05-16

Answer

Thank you very much for the data. Our lab team are working to resolve this as quickly as possible, and we appreciate your patience and understanding! You have provided everything we needed. Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2019-05-16

Question

Is this M00949-Dyl488 anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) reactive to the isotypes of HSPA1A?

G. Jackson

Verified customer

Asked: 2019-04-24

Answer

The immunogen of M00949-Dyl488 anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) is A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp70 (559-596aa KGKISEADKKKVLDKCQEVISWLDANTLAEKDEFEHKR), different from the related mouse sequence by five amino acids, and from the related rat sequence by three amino acids. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?

Boster Scientific Support

Answered: 2019-04-24

Question

I appreciate helping with my inquiry over the phone. Here are the WB image, lot number and protocol we used for pns skin using anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488. Let me know if you need anything else.

Verified Customer

Verified customer

Asked: 2018-11-14

Answer

We appreciate the data. You have provided everything we needed. Our lab team are working to resolve your inquiry as quickly as possible, and we appreciate your patience and understanding! Please let me know if there is anything you need in the meantime.

Boster Scientific Support

Answered: 2018-11-14

Question

I see that the anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 works with Flow Cytometry, what is the protocol used to produce the result images on the product page?

A. Zhang

Verified customer

Asked: 2018-05-02

Answer

You can find protocols for Flow Cytometry on the "support/technical resources" section of our navigation menu. If you have any further questions, please send an email to [email protected]

Boster Scientific Support

Answered: 2018-05-02

Question

Does anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 work for Flow Cytometry with pns skin?

Verified Customer

Verified customer

Asked: 2018-04-18

Answer

According to the expression profile of pns skin, HSPA1A is highly expressed in pns skin. So, it is likely that anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 will work for Flow Cytometry with pns skin.

Boster Scientific Support

Answered: 2018-04-18

Question

Can you help my question with product M00949-Dyl488, anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5). I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?

Verified Customer

Verified customer

Asked: 2018-04-17

Answer

We do not advise storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free M00949-Dyl488 anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5), we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.

Boster Scientific Support

Answered: 2018-04-17

Question

Do you have a BSA free version of anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 available?

C. Collins

Verified customer

Asked: 2017-07-05

Answer

We appreciate your recent telephone inquiry. I can confirm that some lots of this anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) M00949-Dyl488 are BSA free. For now, these lots are available and we can make a BSA free formula for you free of charge. It will take 3 extra days to prepare. If you require this antibody BSA free again in future, please do not hesitate to contact me and I will be pleased to check which lots we have in stock that are BSA free.

Boster Scientific Support

Answered: 2017-07-05

Question

We have seen staining in human cervix carcinoma erythroleukemia. What should we do? Is anti-Human Hsp70 DyLight® 488 conjugated antibody(monoclonal, 3H5) supposed to stain cervix carcinoma erythroleukemia positively?

Verified Customer

Verified customer

Asked: 2017-06-05

Answer

From what I have seen in literature cervix carcinoma erythroleukemia does express HSPA1A. From what I have seen in Uniprot.org, HSPA1A is expressed in endothelial cell, uterus, brain, muscle, pancreas, pns skin, embryonic kidney, brain, cajal-retzius cell fetal brain cortex, cervix carcinoma, cervix carcinoma erythroleukemia, liver, colon carcinoma, among other tissues. Regarding which tissues have HSPA1A expression, here are a few articles citing expression in various tissues:
Brain, Cajal-Retzius cell, and Fetal brain cortex, Pubmed ID: 23349634
Brain, Muscle, Pancreas, PNS, and Skin, Pubmed ID: 15489334
Cervix carcinoma, Pubmed ID: 17081983, 18691976, 20068231
Cervix carcinoma, and Erythroleukemia, Pubmed ID: 23186163
Colon carcinoma, Pubmed ID: 24129315
Liver, Pubmed ID: 24275569
Uterus, Pubmed ID: 14702039

Boster Scientific Support

Answered: 2017-06-05

Order DetailsPrice
M00949-Dyl488

100μg

$515
M00949-Dyl488-carrier-free

Carrier Free

$515

Free Secondary Antibody

Choose an option to show lead time.
Get A Quote
In stock
Order Product
M00949-Dyl488
Buy one primary antibody get one 0.5ml HRP or Biotin secondary antibody for free.
*Sample sizes are prepared on demand and will take extra lead time. (cannot be conjugated)
$515.00

Troubleshooting

troubleshooting-box-image

Download troubleshooting handbooks for IHC, Western blot and ELISA for FREE.

Download Free PDFs Now

Boster Guarantee

Guaranteed product quality

Guaranteed product quality

We promise all of our products perform as described in datasheets.